RNF32 Antibody

Name RNF32 Antibody
Supplier Novus Biologicals
Catalog NBP1-55067
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RNF32(ring finger protein 32) The peptide sequence was selected from the middle region of RNF32. Peptide sequence ACLQAFEKFTNKKTCPLCRKNQYQTRVIHDGARLFRIKCVTRIQAYWRGC.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene RNF32
Conjugate Unconjugated
Supplier Page Shop

Product images