TKTL2 Antibody
| Name | TKTL2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55173 |
| Prices | $299.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Bovine, Horse, Guinea Pig, Rabbit |
| Antigen | Synthetic peptides corresponding to TKTL2(transketolase-like 2) The peptide sequence was selected from the C terminal of TKTL2. Peptide sequence SSAKATGGRVITVEDHYREGGIGEAVCAAVSREPDILVHQLAVSGVPQRG. |
| Purity/Format | IgG purified |
| Description | Rabbit Polyclonal |
| Gene | TKTL2 |
| Supplier Page | Shop |
Product images
![Western Blot: TKTL2 Antibody [NBP1-55173] - Jurkat cell lysate, concentration 2.5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/9504_TKTL2%2520Antibody-Western%2520Blot-NBP1-55173-img0002.jpg)
Western Blot: TKTL2 Antibody [NBP1-55173] - Jurkat cell lysate, concentration 2.5 ug/ml.