Name | NSUN3 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-55170 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Bovine, Dog, Horse, Guinea Pig, Rabbit |
Antigen | Synthetic peptides corresponding to NSUN3(NOL1/NOP2/Sun domain family, member 3) The peptide sequence was selected from the C terminal of NSUN3. Peptide sequence LPLLQIELLRSAIKALRPGGILVYSTCTLSKAENQDVISEILNSHGNIMP. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | NSUN3 |
Supplier Page | Shop |