NSUN3 Antibody

Name NSUN3 Antibody
Supplier Novus Biologicals
Catalog NBP1-55170
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Bovine, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to NSUN3(NOL1/NOP2/Sun domain family, member 3) The peptide sequence was selected from the C terminal of NSUN3. Peptide sequence LPLLQIELLRSAIKALRPGGILVYSTCTLSKAENQDVISEILNSHGNIMP.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene NSUN3
Supplier Page Shop

Product images