SEPHS1 Antibody

Name SEPHS1 Antibody
Supplier Novus Biologicals
Catalog NBP1-55167
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SEPHS1(selenophosphate synthetase 1) The peptide sequence was selected from the C terminal of SEPHS1 (NP_036379). Peptide sequence PKYGEGHQAWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGATS.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene SEPHS1
Conjugate Unconjugated
Supplier Page Shop

Product images