Name | SEPHS1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-55167 |
Prices | $139.00, $299.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to SEPHS1(selenophosphate synthetase 1) The peptide sequence was selected from the C terminal of SEPHS1 (NP_036379). Peptide sequence PKYGEGHQAWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGATS. |
Purity/Format | Protein A purified |
Description | Rabbit Polyclonal |
Gene | SEPHS1 |
Conjugate | Unconjugated |
Supplier Page | Shop |