Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-55107
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to B3GNT4(UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4) The peptide sequence was selected from the N terminal of B3GNT4. Peptide sequence MLPPQPSAAHQGRGGRSGLLPKGPAMLCRLCWLVSYSLAVLLLGCLLFLR.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: B3GNT4
• Conjugate: Unconjugated