GSTM2 Antibody
| Name | GSTM2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55103 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to GSTM2(glutathione S-transferase M2 (muscle)) The peptide sequence was selected from the N terminal of GSTM2. Peptide sequence TQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDF. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | GSTM2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: GSTM2 Antibody [NBP1-55103] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29742_GSTM2-Antibody-Western-Blot-NBP1-55103-img0006.jpg)
Western Blot: GSTM2 Antibody [NBP1-55103] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml
![Immunohistochemistry-Paraffin: GSTM2 Antibody [NBP1-55103] - Human Skeletal Muscle lysate tissue at an antibody concentration of 5.0ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29743_GSTM2-Antibody-Immunohistochemistry-Paraffin-NBP1-55103-img0005.jpg)
Immunohistochemistry-Paraffin: GSTM2 Antibody [NBP1-55103] - Human Skeletal Muscle lysate tissue at an antibody concentration of 5.0ug/ml.
![Western Blot: GSTM2 Antibody [NBP1-55103] - Reccomended Titration: 0.2 - 1 ug/ml Positive Control: Human Liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29744_GSTM2%2520Antibody-Western%2520Blot-NBP1-55103-img0007.jpg)
Western Blot: GSTM2 Antibody [NBP1-55103] - Reccomended Titration: 0.2 - 1 ug/ml Positive Control: Human Liver
![Immunohistochemistry-Paraffin: GSTM2 Antibody [NBP1-55103] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29745_GSTM2-Antibody-Immunohistochemistry-Paraffin-NBP1-55103-img0004.jpg)
Immunohistochemistry-Paraffin: GSTM2 Antibody [NBP1-55103] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.