Ankyrin 1 Antibody
| Name | Ankyrin 1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55102 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ANK1(ankyrin 1, erythrocytic) The peptide sequence was selected from the middle region of ANK1 (NP_065210). Peptide sequence PCAMPETVVIRSEEQEQASKEYDEDSLIPSSPATETSDNISPVASPVHTG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ANK1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: Ankyrin 1 Antibody [NBP1-55102] - Titration: 0.2-1 ug/ml, Positive Control: HT1080 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7373_Ankyrin-1-Antibody-Western-Blot-NBP1-55102-img0003.jpg)
![Western Blot: Ankyrin 1 Antibody [NBP1-55102] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7374_Ankyrin%25201%2520Antibody-Western%2520Blot-NBP1-55102-img0004.jpg)