Angiomotin like 1 Antibody

Name Angiomotin like 1 Antibody
Supplier Novus Biologicals
Catalog NBP1-55099
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to AMOTL1(angiomotin like 1) The peptide sequence was selected from the N terminal of AMOTL1. Peptide sequence LTQEDPQMVYQSARQEPQGQEHQVDNTVMEKQVRSTQPQQNNEELPTYEE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene AMOTL1
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.