CRYBB3 Antibody

Name CRYBB3 Antibody
Supplier Novus Biologicals
Catalog NBP1-55088
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CRYBB3(crystallin, beta B3) The peptide sequence was selected from the middle region of CRYBB3. Peptide sequence LNIDSPHHKLHLFENPAFSGRKMEIVDDDVPSLWAHGFQDRVASVRAING.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CRYBB3
Conjugate Unconjugated
Supplier Page Shop

Product images