TRMT61A Antibody
| Name | TRMT61A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55087 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to C14ORF172 The peptide sequence was selected from the N terminal of C14ORF172. Peptide sequence MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLI. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TRMT61A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: TRMT61A Antibody [NBP1-55087] - SH-SYSY cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15396_TRMT61A%2520Antibody-Western%2520Blot-NBP1-55087-img0002.jpg)
Western Blot: TRMT61A Antibody [NBP1-55087] - SH-SYSY cell lysate, concentration 0.2-1 ug/ml.