HECTD2 Antibody

Name HECTD2 Antibody
Supplier Novus Biologicals
Catalog NBP1-55081
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Bovine, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to HECTD2(HECT domain containing 2) The peptide sequence was selected from the C terminal of HECTD2. Peptide sequence TDLTIKYFWDVVLGFPLDLQKKLLHFTTGSDRVPVGGMADLNFKISKNET.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene HECTD2
Supplier Page Shop

Product images