Name | HECTD2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-55081 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Bovine, Dog, Horse, Guinea Pig, Rabbit |
Antigen | Synthetic peptides corresponding to HECTD2(HECT domain containing 2) The peptide sequence was selected from the C terminal of HECTD2. Peptide sequence TDLTIKYFWDVVLGFPLDLQKKLLHFTTGSDRVPVGGMADLNFKISKNET. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | HECTD2 |
Supplier Page | Shop |