DRG1 Antibody

Name DRG1 Antibody
Supplier Novus Biologicals
Catalog NBP1-55158
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to DRG1(developmentally regulated GTP binding protein 1) The peptide sequence was selected from the middle region of DRG1. Peptide sequence VLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSEL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DRG1
Conjugate Unconjugated
Supplier Page Shop

Product images