OSBPL3 Antibody

Name OSBPL3 Antibody
Supplier Novus Biologicals
Catalog NBP1-55151
Prices $139.00, $369.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to OSBPL3(oxysterol binding protein-like 3) The peptide sequence was selected from the N terminal of OSBPL3 (NP_663160). Peptide sequence MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMNYTQE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene OSBPL3
Conjugate Unconjugated
Supplier Page Shop

Product images