non-muscle heavy chain 10 Myosin Antibody
| Name | non-muscle heavy chain 10 Myosin Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55146 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to MYH10(myosin, heavy chain 10, non-muscle) The peptide sequence was selected from the N terminal of MYH10. Peptide sequence WFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKAD. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | MYH10 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: non-muscle heavy chain 10 Myosin Antibody [NBP1-55146] - Titration: 0.2-1 ug/ml, Positive Control: Human Lung.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16496_non-muscle%2520heavy%2520chain%252010%2520Myosin%2520Antibody-Western%2520Blot-NBP1-55146-img0003.jpg)
Western Blot: non-muscle heavy chain 10 Myosin Antibody [NBP1-55146] - Titration: 0.2-1 ug/ml, Positive Control: Human Lung.