Chimaerin 2 Antibody

Name Chimaerin 2 Antibody
Supplier Novus Biologicals
Catalog NBP1-55257
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CHN2(chimerin (chimaerin) 2) The peptide sequence was selected from the N terminal of CHN2. Peptide sequence NHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQC.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CHN2
Conjugate Unconjugated
Supplier Page Shop

Product images