GIPC2 Antibody
| Name | GIPC2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55244 |
| Prices | $299.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | Synthetic peptides corresponding to GIPC2 (GIPC PDZ domain containing family, member 2) The peptide sequence was selected from the N terminal of GIPC2. Peptide sequence MPLKLRGKKKAKSKETAGLVEGEPTGAGGGSLSASRAPARRLVFHAQLAH. |
| Purity/Format | IgG purified |
| Description | Rabbit Polyclonal |
| Gene | GIPC2 |
| Supplier Page | Shop |
Product images
![Western Blot: GIPC2 Antibody [NBP1-55244] - Jurkat cell lysate, Antibody Titration: 1.25ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/9541_GIPC2%2520Antibody-Western%2520Blot-NBP1-55244-img0001.jpg)
Western Blot: GIPC2 Antibody [NBP1-55244] - Jurkat cell lysate, Antibody Titration: 1.25ug/ml
![Immunohistochemistry-Paraffin: GIPC2 Antibody [NBP1-55244] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/9542_GIPC2%2520Antibody-Immunohistochemistry-Paraffin-NBP1-55244-img0002.jpg)
Immunohistochemistry-Paraffin: GIPC2 Antibody [NBP1-55244] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.