GMPPA Antibody

Name GMPPA Antibody
Supplier Novus Biologicals
Catalog NBP1-55233
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to GMPPA(GDP-mannose pyrophosphorylase A) The peptide sequence was selected from the N terminal of GMPPA. Peptide sequence LKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQ.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene GMPPA
Conjugate Unconjugated
Supplier Page Shop

Product images