Proprotein convertase PC4 Antibody

Name Proprotein convertase PC4 Antibody
Supplier Novus Biologicals
Catalog NBP1-55224
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PCSK4(proprotein convertase subtilisin/kexin type 4) The peptide sequence was selected from the N terminal of PCSK4. Peptide sequence VSSWAVQVSQGNREVERLARKFGFVNLGPIFPDGQYFHLRHRGVVQQSLT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PCSK4
Conjugate Unconjugated
Supplier Page Shop

Product images