ATP6V1A Antibody

Name ATP6V1A Antibody
Supplier Novus Biologicals
Catalog NBP1-55212
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Dog, Rabbit
Antigen Synthetic peptides corresponding to ATP6V1A(ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A) The peptide sequence was selected from the N terminal of ATP6V1A. Peptide sequence SGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPR.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene ATP6V1A
Supplier Page Shop

Product images