MTMR12 Antibody

Name MTMR12 Antibody
Supplier Novus Biologicals
Catalog NBP1-55211
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MTMR12(myotubularin related protein 12) The peptide sequence was selected from the middle region of MTMR12. Peptide sequence PLYVEKPKLDKGQRKGMRFKHQRQLSLPLTQSKSSPKRGFFREETDHLIK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MTMR12
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.