COG4 Antibody
| Name | COG4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55198 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to COG4(component of oligomeric golgi complex 4) The peptide sequence was selected from the middle region of COG4. Peptide sequence LFSQGIGGEQAQAKFDSCLSDLAAVSNKFRDLLQEGLTELNSTAIKPQVQ. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | COG4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: COG4 Antibody [NBP1-55198] - 1. Human Cervical Cancer Cell lysate (15ug) 2. Monkey Fibroblast Cell lysate (15ug) 3. Human Cervical Cancer Cell transfected with Myc-COG4 (15ug) Primary Dilution: 1 : 1000 Secondary Antibody: goat anti-Rabbit Secondary Dilution: 1 : 40,000.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/29965_COG4-Antibody-Western-Blot-NBP1-55198-img0003.jpg)
Western Blot: COG4 Antibody [NBP1-55198] - 1. Human Cervical Cancer Cell lysate (15ug) 2. Monkey Fibroblast Cell lysate (15ug) 3. Human Cervical Cancer Cell transfected with Myc-COG4 (15ug) Primary Dilution: 1 : 1000 Secondary Antibody: goat anti-Rabbit Secondary Dilution: 1 : 40,000.
![Western Blot: COG4 Antibody [NBP1-55198] - HeLa, Vera, HeLa transfected with mouse construct, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/29966_COG4-Antibody-Western-Blot-NBP1-55198-img0002.jpg)
Western Blot: COG4 Antibody [NBP1-55198] - HeLa, Vera, HeLa transfected with mouse construct, Antibody Titration: 0.2-1 ug/ml