KLHDC1 Antibody

Name KLHDC1 Antibody
Supplier Novus Biologicals
Catalog NBP1-55193
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Rabbit
Antigen Synthetic peptides corresponding to KLHDC1(kelch domain containing 1) The peptide sequence was selected from the N terminal of KLHDC1. Peptide sequence IDSGLWRMHLMEGELPASMSGSCGACINGKLYIFGGYDDKGYSNRLYFVN.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene KLHDC1
Supplier Page Shop

Product images