Name | KLHDC1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-55193 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Rabbit |
Antigen | Synthetic peptides corresponding to KLHDC1(kelch domain containing 1) The peptide sequence was selected from the N terminal of KLHDC1. Peptide sequence IDSGLWRMHLMEGELPASMSGSCGACINGKLYIFGGYDDKGYSNRLYFVN. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | KLHDC1 |
Supplier Page | Shop |