TIGD4 Antibody

Name TIGD4 Antibody
Supplier Novus Biologicals
Catalog NBP1-55190
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TIGD4(tigger transposable element derived 4) The peptide sequence was selected from the N terminal of TIGD4. Peptide sequence RFDPKRKRLRTAFYTDLEEALMRWYRIAQCLNVPVNGPMLRLKANDFAQK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TIGD4
Conjugate Unconjugated
Supplier Page Shop

Product images