GNB2 Antibody

Name GNB2 Antibody
Supplier Novus Biologicals
Catalog NBP1-55323
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to GNB2(guanine nucleotide binding protein (G protein), beta polypeptide 2) The peptide sequence was selected from the middle region of GNB2. Peptide sequence CCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAP
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene GNB2
Conjugate Unconjugated
Supplier Page Shop

Product images