G protein alpha 12 Antibody
| Name | G protein alpha 12 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55321 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Zebrafish |
| Antigen | Synthetic peptides corresponding to GNA12(guanine nucleotide binding protein (G protein) alpha 12) The peptide sequence was selected from the middle region of GNA12. Peptide sequence TFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYFLDNLDRIGQLNYF. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | GNA12 |
| Supplier Page | Shop |
Product images
![Western Blot: G protein alpha 12 Antibody [NBP1-55321] - Titration: 0.2-1 ug/ml, Positive Control: Human Liver.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/9566_G%2520protein%2520alpha%252012%2520Antibody-Western%2520Blot-NBP1-55321-img0003.jpg)
Western Blot: G protein alpha 12 Antibody [NBP1-55321] - Titration: 0.2-1 ug/ml, Positive Control: Human Liver.