CIB3 Antibody

Name CIB3 Antibody
Supplier Novus Biologicals
Catalog NBP1-55314
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Sheep
Antigen Synthetic peptides corresponding to CIB3(calcium and integrin binding family member 3) The peptide sequence was selected from the N terminal of CIB3. Peptide sequence QDLAPQLVPLDYTTCPDVKVPYELIGSMPELKDNPFRQRIAQVFSEDGDG.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene CIB3
Supplier Page Shop

Product images