Name | CIB3 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-55314 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Bovine, Dog, Sheep |
Antigen | Synthetic peptides corresponding to CIB3(calcium and integrin binding family member 3) The peptide sequence was selected from the N terminal of CIB3. Peptide sequence QDLAPQLVPLDYTTCPDVKVPYELIGSMPELKDNPFRQRIAQVFSEDGDG. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | CIB3 |
Supplier Page | Shop |