RNF39 Antibody
| Name | RNF39 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55282 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Horse |
| Antigen | Synthetic peptides corresponding to RNF39(ring finger protein 39) The peptide sequence was selected from the N terminal of RNF39. Peptide sequence EGRKAAKVNAGVGEKGIYTASSRGGPPSARSKAVTVVAEGAASRSWLSMD. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RNF39 |
| Supplier Page | Shop |
Product images
![Western Blot: RNF39 Antibody [NBP1-55282] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/9573_RNF39%2520Antibody-Western%2520Blot-NBP1-55282-img0001.jpg)
Western Blot: RNF39 Antibody [NBP1-55282] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml
![Immunohistochemistry-Paraffin: RNF39 Antibody [NBP1-55282] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/9574_RNF39%2520Antibody-Immunohistochemistry-Paraffin-NBP1-55282-img0002.jpg)
Immunohistochemistry-Paraffin: RNF39 Antibody [NBP1-55282] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.