PITPNB Antibody
| Name | PITPNB Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55310 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PITPNB(phosphatidylinositol transfer protein, beta) The peptide sequence was selected from the middle region of PITPNB. Peptide sequence ADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANSPDCPQMCAY. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PITPNB |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PITPNB Antibody [NBP1-55310] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1 : 12500 Positive control: 721_B cell lysate PITPNB is supported by BioGPS gene expression data to be expressed in 721_B.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15363_PITPNB%2520Antibody-Western%2520Blot-NBP1-55310-img0003.jpg)
Western Blot: PITPNB Antibody [NBP1-55310] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1 : 12500 Positive control: 721_B cell lysate PITPNB is supported by BioGPS gene expression data to be expressed in 721_B.