GNB1 Antibody

Name GNB1 Antibody
Supplier Novus Biologicals
Catalog NBP1-55307
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to GNB1(guanine nucleotide binding protein (G protein), beta polypeptide 1) The peptide sequence was selected from the N terminal of GNB1. Peptide sequence MSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRT
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene GNB1
Conjugate Unconjugated
Supplier Page Shop

Product images