EXOD1 Antibody
| Name | EXOD1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55303 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ERI2(ERI1 exoribonuclease family member 2) The peptide sequence was selected from the middle region of ERI2 (NP_542394). Peptide sequence LQEVGIEFSGREHSGLDDSRNTALLAWKMIRDGCVMKITRSLNKGPFLLP. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ERI2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: EXOD1 Antibody [NBP1-55303] - Human 721_B, Antibody Dilution: 1.0 ug/ml ERI2 is supported by BioGPS gene expression data to be expressed in 721_B.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24426_EXOD1-Antibody-Western-Blot-NBP1-55303-img0003.jpg)
Western Blot: EXOD1 Antibody [NBP1-55303] - Human 721_B, Antibody Dilution: 1.0 ug/ml ERI2 is supported by BioGPS gene expression data to be expressed in 721_B.
![Western Blot: EXOD1 Antibody [NBP1-55303] - Jurkat cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24427_EXOD1-Antibody-Western-Blot-NBP1-55303-img0002.jpg)
Western Blot: EXOD1 Antibody [NBP1-55303] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
![Western Blot: EXOD1 Antibody [NBP1-55303] - Human HepG2, Antibody Dilution: 1.0 ug/ml ERI2 is supported by BioGPS gene expression data to be expressed in HepG2.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24428_EXOD1%2520Antibody-Western%2520Blot-NBP1-55303-img0004.jpg)
Western Blot: EXOD1 Antibody [NBP1-55303] - Human HepG2, Antibody Dilution: 1.0 ug/ml ERI2 is supported by BioGPS gene expression data to be expressed in HepG2.