RLBP1L1 Antibody

Name RLBP1L1 Antibody
Supplier Novus Biologicals
Catalog NBP1-55291
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RLBP1L1(retinaldehyde binding protein 1-like 1) The peptide sequence was selected from the N terminal of RLBP1L1. Peptide sequence NFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFTDIL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CLVS1
Conjugate Unconjugated
Supplier Page Shop

Product images