NUDT16L1 Antibody

Name NUDT16L1 Antibody
Supplier Novus Biologicals
Catalog NBP1-55432
Prices $299.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Rat, Bovine, Dog, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to NUDT16L1(nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1) The peptide sequence was selected from the C terminal of NUDT16L1. Peptide sequence GLVRVPLYTQKDRVGGFPNFLSNAFVSTAKCQLLFALKVLN
Purity/Format IgG purified
Description Rabbit Polyclonal
Gene NUDT16L1
Supplier Page Shop

Product images