PARP7 Antibody

Name PARP7 Antibody
Supplier Novus Biologicals
Catalog NBP1-55363
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TIPARP(TCDD-inducible poly(ADP-ribose) polymerase) The peptide sequence was selected from the N terminal of TIPARP. Peptide sequence LKTCFKKKDQKRLGTGTLRSLRPILNTLLESGSLDGVFRSRNQSTDENSL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TIPARP
Conjugate Unconjugated
Supplier Page Shop

Product images