Name | PARP7 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-55363 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to TIPARP(TCDD-inducible poly(ADP-ribose) polymerase) The peptide sequence was selected from the N terminal of TIPARP. Peptide sequence LKTCFKKKDQKRLGTGTLRSLRPILNTLLESGSLDGVFRSRNQSTDENSL. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | TIPARP |
Conjugate | Unconjugated |
Supplier Page | Shop |