GPN2 Antibody

Name GPN2 Antibody
Supplier Novus Biologicals
Catalog NBP1-55359
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to GPN2 (GPN-loop GTPase 2) The peptide sequence was selected from the middle region of GPN2. Peptide sequence VLQAVDKANGYCFRAQEQRSLEAMMSAAMGADFHFSSTLGIQEKYLAPSN.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene GPN2
Conjugate Unconjugated
Supplier Page Shop

Product images