Isoleucyl tRNA synthetase Antibody

Name Isoleucyl tRNA synthetase Antibody
Supplier Novus Biologicals
Catalog NBP1-55357
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to IARS(isoleucyl-tRNA synthetase) The peptide sequence was selected from the middle region of IARS. Peptide sequence YEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTAD.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene IARS
Conjugate Unconjugated
Supplier Page Shop

Product images