TNP1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-55356
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to TNP1(transition protein 1 (during histone to protamine replacement)) The peptide sequence was selected from the N terminal of TNP1. Peptide sequence MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRN.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: TNP1
• Conjugate: Unconjugated