Uridine Phosphorylase 1/UPP1 Antibody
| Name | Uridine Phosphorylase 1/UPP1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55355 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to UPP1(uridine phosphorylase 1) The peptide sequence was selected from the middle region of UPP1. Peptide sequence ACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKLSK. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | UPP1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Uridine Phosphorylase 1/UPP1 Antibody [NBP1-55355] - Titration: 0.2-1 ug/ml, Positive Control: OVCAR-3 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16157_Uridine-Phosphorylase-1-UPP1-Antibody-Western-Blot-NBP1-55355-img0004.jpg)
Western Blot: Uridine Phosphorylase 1/UPP1 Antibody [NBP1-55355] - Titration: 0.2-1 ug/ml, Positive Control: OVCAR-3 cell lysate.