FAM108B1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-55352
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to FAM108B1(family with sequence similarity 108, member B1) The peptide sequence was selected from the middle region of FAM108B1. Peptide sequence SSFYIGLGSRINCNIFSYDYSGYGASSGKPTEKNLYADIEAAWLALRTRY.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: ABHD17B
• Conjugate: Unconjugated