TSR1 Antibody

Name TSR1 Antibody
Supplier Novus Biologicals
Catalog NBP1-55349
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TSR1(TSR1, 20S rRNA accumulation, homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of TSR1. Peptide sequence MALVATVYAPITFPPASVLLFKQKSNGMHSLIATGHLMSVDPDRMVIKRV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TSR1
Conjugate Unconjugated
Supplier Page Shop

Product images