PRR11 Antibody
| Name | PRR11 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55346 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Bovine, Dog, Guinea Pig, Rabbit |
| Antigen | Synthetic peptides corresponding to PRR11(proline rich 11) The peptide sequence was selected from the middle region of PRR11. Peptide sequence PGKSQMDLRKLLRKVDVERSPGGTPLTNKENMETGTGLTPVMTQALRRKF. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PRR11 |
| Supplier Page | Shop |
Product images
![Western Blot: PRR11 Antibody [NBP1-55346] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/9602_PRR11%2520Antibody-Western%2520Blot-NBP1-55346-img0004.jpg)
Western Blot: PRR11 Antibody [NBP1-55346] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.