SPG20 Antibody

Name SPG20 Antibody
Supplier Novus Biologicals
Catalog NBP1-55345
Prices $139.00, $329.00
Sizes 20 µl, 50 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SPG20(spastic paraplegia 20 (Troyer syndrome)) The peptide sequence was selected from the middle region of SPG20. Peptide sequence ASWVSWGLVKGAEITGKAIQKGASKLRERIQPEEKPVEVSPAVTKGLYIA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SPG20
Conjugate Unconjugated
Supplier Page Shop

Product images