Name | SPG20 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-55345 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 50 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to SPG20(spastic paraplegia 20 (Troyer syndrome)) The peptide sequence was selected from the middle region of SPG20. Peptide sequence ASWVSWGLVKGAEITGKAIQKGASKLRERIQPEEKPVEVSPAVTKGLYIA. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | SPG20 |
Conjugate | Unconjugated |
Supplier Page | Shop |