RAB3IL1 Antibody

Name RAB3IL1 Antibody
Supplier Novus Biologicals
Catalog NBP1-55343
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RAB3IL1(RAB3A interacting protein (rabin3)-like 1) The peptide sequence was selected from the middle region of RAB3IL1. Peptide sequence ARGKIDMLQAEVTALKTLVITSTPASPNRELHPQLLSPTKAGPRKGHSRH.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RAB3IL1
Conjugate Unconjugated
Supplier Page Shop

Product images