PSD3 Antibody

Name PSD3 Antibody
Supplier Novus Biologicals
Catalog NBP1-55338
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PSD3(pleckstrin and Sec7 domain containing 3) The peptide sequence was selected from the middle region of PSD3. Peptide sequence PDSYFSFEMPLTPMIQQRIKEGGQFLERTSGGGHQDILSVSADGGIVMGY.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PSD3
Conjugate Unconjugated
Supplier Page Shop

Product images