FBXO27 Antibody

Name FBXO27 Antibody
Supplier Novus Biologicals
Catalog NBP1-55337
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FBXO27(F-box protein 27) The peptide sequence was selected from the middle region of FBXO27. Peptide sequence LDKFSAVPDPIPQWNNNACLHVTHVFSNIKMGVRFVSFEHRGQDTQFWAG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FBXO27
Conjugate Unconjugated
Supplier Page Shop

Product images