Name | FBXO27 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-55337 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to FBXO27(F-box protein 27) The peptide sequence was selected from the middle region of FBXO27. Peptide sequence LDKFSAVPDPIPQWNNNACLHVTHVFSNIKMGVRFVSFEHRGQDTQFWAG. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | FBXO27 |
Conjugate | Unconjugated |
Supplier Page | Shop |