KLHL7 Antibody

Name KLHL7 Antibody
Supplier Novus Biologicals
Catalog NBP1-55462
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to KLHL7(kelch-like 7 (Drosophila)) The peptide sequence was selected from the middle region of KLHL7. Peptide sequence AVGSIVYVLAGFQGVGRLGHILEYNTETDKWVANSKVRAFPVTSCLICVV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene KLHL7
Conjugate Unconjugated
Supplier Page Shop

Product images