TMED8 Antibody

Name TMED8 Antibody
Supplier Novus Biologicals
Catalog NBP1-55452
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TMED8(transmembrane emp24 protein transport domain containing 8) The peptide sequence was selected from the middle region of TMED8. Peptide sequence EIEEPVPAGDVERGSRSSLRGRYGEVMPVYRRDSHRDVQAGSHDYPGEGI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TMED8
Conjugate Unconjugated
Supplier Page Shop

Product images