AP3S1 Antibody
| Name | AP3S1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55449 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Bovine, Dog |
| Antigen | Synthetic peptides corresponding to AP3S1(adaptor-related protein complex 3, sigma 1 subunit) The peptide sequence was selected from the N terminal of AP3S1 (NP_001275). Peptide sequence IKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLE. |
| Purity/Format | Affinity purified |
| Description | Rabbit Polyclonal |
| Gene | AP3S1 |
| Supplier Page | Shop |
Product images
![Western Blot: AP3S1 Antibody [NBP1-55449] - Jurkat cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/9624_AP3S1%2520Antibody-Western%2520Blot-NBP1-55449-img0002.jpg)
Western Blot: AP3S1 Antibody [NBP1-55449] - Jurkat cell lysate, concentration 0.2-1 ug/ml.