Name | UEVLD Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-55444 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Pig, Bovine, Dog, Horse, Rabbit |
Antigen | Synthetic peptides corresponding to UEVLD(UEV and lactate/malate dehyrogenase domains) The peptide sequence was selected from the middle region of UEVLD. Peptide sequence SLSSSDEARQVDLLAYIAKITEGVSDTNSKSWANHENKTVNKITVVGGGE. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | UEVLD |
Supplier Page | Shop |