UEVLD Antibody

Name UEVLD Antibody
Supplier Novus Biologicals
Catalog NBP1-55444
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Pig, Bovine, Dog, Horse, Rabbit
Antigen Synthetic peptides corresponding to UEVLD(UEV and lactate/malate dehyrogenase domains) The peptide sequence was selected from the middle region of UEVLD. Peptide sequence SLSSSDEARQVDLLAYIAKITEGVSDTNSKSWANHENKTVNKITVVGGGE.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene UEVLD
Supplier Page Shop

Product images