Lebercilin Antibody

Name Lebercilin Antibody
Supplier Novus Biologicals
Catalog NBP1-55416
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to Lebercilin. The peptide sequence was selected from the N terminal of Lebercilin. Peptide sequence FSLQKLKEISEARHLPERDDLAKKLVSAELKLDDTERRIKELSKNLELST.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LCA5
Conjugate Unconjugated
Supplier Page Shop

Product images