NOB1 Antibody

Name NOB1 Antibody
Supplier Novus Biologicals
Catalog NBP1-55404
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to NOB1(NIN1/RPN12 binding protein 1 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of NOB1. Peptide sequence TEIRDKATRRRLAVLPYELRFKEPLPEYVRLVTEFSKKTGDYPSLSATDI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene NOB1
Conjugate Unconjugated
Supplier Page Shop

Product images